2.50 Rating by CuteStat

gidertikanikligiacma.com is 6 years 7 months old. It is a domain having com extension. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, gidertikanikligiacma.com is SAFE to browse.

PageSpeed Score
50
Siteadvisor Rating
Not Applicable

Traffic Report

Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: Not Applicable
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

77.92.140.32

Hosted Country:

Türkiye TR

Location Latitude:

41.0214

Location Longitude:

28.9948
Gider Tıkanıklığı Açma

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: Not Applicable H2 Headings: 1
H3 Headings: 3 H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 2
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 77.92.140.32)

Kötü Sözlük'tü.

- kotusozluk.com
4,085,720 $ 240.00

Tam Haber | Güncel Haberler ve Son Dakika Haberleri

- tamhaber.com.tr

Tüm sosyal medya, gazete ve internet haberleri, köşe yazarları, son dakika haberler ve halk için habercilik anlayışı ile Türkiye'nin gerçek haber sitesi.

7,102,027 $ 240.00

Index of /

- chicopeekedikopekmamalari.com
Not Applicable $ 8.95

Maya Cupcake | Harika Cupcake Çeşitleri

- mayacupcake.com

Doğumgünü, düğün ve özel gün cupcake çeşitlerimiz ile karşınızdayız.

19,998,643 $ 8.95

Index of /

- tuvalettikanikligiacmafiyatlari.net
Not Applicable $ 8.95

HTTP Header Analysis

HTTP/1.1 200 OK
Date: Sat, 11 Nov 2017 07:10:04 GMT
Server: Apache
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0
Pragma: no-cache
Link: <http://gidertikanikligiacma.com/wp-json/>; rel="https://api.w.org/", <http://gidertikanikligiacma.com/>; rel=shortlink
Content-Type: text/html; charset=UTF-8
X-Cache: MISS from proxy-node-0003
X-Cache-Lookup: MISS from proxy-node-0003:4896
Transfer-Encoding: chunked
Via: 1.1 proxy-node-0003 (squid/3.5.12)
Connection: keep-alive

Domain Information

Domain Registrar: FBS Inc.
Registration Date: Nov 9, 2017, 12:00 AM 6 years 7 months 1 week ago
Last Modified: Nov 9, 2017, 12:00 AM 6 years 7 months 1 week ago
Domain Status:
clientTransferProhibited

Domain Nameserver Information

Host IP Address Country
ns1.kotuhost.com 212.68.61.245 Türkiye Türkiye
ns2.kotuhost.com 212.68.61.231 Türkiye Türkiye

DNS Record Analysis

Host Type TTL Extra
gidertikanikligiacma.com A 14400 IP: 77.92.140.32
gidertikanikligiacma.com NS 86400 Target: ns1.kotuhost.com
gidertikanikligiacma.com NS 86400 Target: ns2.kotuhost.com
gidertikanikligiacma.com SOA 86400 MNAME: ns1.kotuhost.com
RNAME: destek.labina.com.tr
Serial: 2017110903
Refresh: 3600
Retry: 7200
Expire: 1209600
Minimum TTL: 86400
gidertikanikligiacma.com MX 14400 Target: gidertikanikligiacma.com
gidertikanikligiacma.com TXT 14400 TXT: v=spf1 +a +mx +ip4:77.92.140.32 ~all

Full WHOIS Lookup

Domain Name: GIDERTIKANIKLIGIACMA.COM
Registry Domain ID: 2185084168_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.isimtescil.net
Registrar URL: http://www.isimtescil.net
Updated Date: 2017-11-09T13:22:08Z
Creation Date: 2017-11-09T13:20:26Z
Registry Expiry Date: 2018-11-09T13:20:26Z
Registrar: FBS Inc.
Registrar IANA ID: 1110
Registrar Abuse Contact Email: abuse@domaintime.biz
Registrar Abuse Contact Phone: 90.8502000444
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Name Server: NS1.KOTUHOST.COM
Name Server: NS2.KOTUHOST.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2017-11-11T07:09:50Z